Search Results Page | Fisher Scientific

Search results for "iba+stimulation+peptide"

There were no precise results for "iba+stimulation+peptide". Showing all possible results.

1 – 15 of 128 results

IBA Lifesciences Strep-Tactin™XT 4Flow™ Starter Kit

Strep-Tactin™XT 4Flow™ Starter Kit contains all reagents required for purification and detection of Strep-tagII™ and Twin-Strep-tag™ fusion proteins

Pricing and Availability

Protein Purification Reagents and Kits

Bio-Techne CREG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Antigen	CREG2
Gene Symbols	CREG2
Regulatory Status	RUO
Molecular Weight of Antigen	32 kDa
Gene Alias	cellular repressor of E1A-stimulated genes 2
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Gene ID (Entrez)	200407
Immunogen	Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH.
Classification	Polyclonal
Isotype	IgG
Primary or Secondary	Primary

IBA Lifesciences 1x Buffer XT-R - Regeneration Buffer

Buffer XT-R is a Strep-Tactin™XT regeneration buffer with magnesium chloride

Pricing and Availability

Life Science Buffers

Bio-Techne STRA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	Q9BX79
Antigen	STRA6
Gene Symbols	STRA6
Regulatory Status	RUO
Molecular Weight of Antigen	73 kDa
Gene Alias	FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog
Gene ID (Entrez)	64220
Immunogen	Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG.
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne TP53I13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	NP_612358
Antigen	TP53I13
Gene Symbols	TP53I13
Regulatory Status	RUO
Molecular Weight of Antigen	42 kDa
Gene Alias	DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
Gene ID (Entrez)	90313
Immunogen	Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE.
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability

All Primary Antibodies

Bio-Techne ACTH Antibody (CLIP/1407), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),SDS-Page,Immunofluorescence
Form	Purified
Isotype	IgG
Gene Accession No.	P01189
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Antigen	ACTH
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Flow Cytometry 0.5-1ug/million cells, Immunohistochemistry-Paraffin 0.5-1ug/ml, SDS-Page, Immunofluorescence 1-2ug/ml
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	10mM PBS and 0.05% BSA with 0.05% Sodium Azide
Immunogen	Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF)
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone	CLIP/1407

Bio-Techne Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability

All Primary Antibodies

Bio-Techne ACTH Antibody (CLIP/1407) - Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Immunohistochemistry (Paraffin),Immunofluorescence,CyTOF
Form	Purified
Isotype	IgG
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Concentration	1.0 mg/mL
Antigen	ACTH
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Flow Cytometry : 0.5-1ug/million cells, ELISA, Immunohistochemistry-Paraffin : 0.5-1ug/ml, Immunofluorescence : 1-2ug/ml, CyTOF-ready
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	PBS with No Preservative
Immunogen	Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF)
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone	CLIP/1407

Bio-Techne ACTH Mouse, Clone: AH26 + 57, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG
Gene Accession No.	P01189
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Antigen	ACTH
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A purified
Dilution	Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen	Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone	AH26 + 57

Novus Biologicals STRA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	Q7Z7C7
Antigen	STRA8
Gene Symbols	STRA8
Regulatory Status	RUO
Dilution	Western Blot 1.0 ug/ml
Molecular Weight of Antigen	37 kDa
Gene Alias	stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog
Gene ID (Entrez)	346673
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen	The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED.
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne ACTH Mouse, Clone: SPM333, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	P01189
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Antigen	ACTH
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 1-2ug/ml, Immunohistochemistry-Paraffin 0.5-1.0ug/ml
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen	Synthetic peptide corresponding to aa1-24 of human ACTH
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone	SPM333

Bio-Techne TP53I13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	NP_612358
Antigen	TP53I13
Gene Symbols	TP53I13
Regulatory Status	RUO
Molecular Weight of Antigen	42 kDa
Gene Alias	DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
Gene ID (Entrez)	90313
Immunogen	Synthetic peptide directed towards the middle region of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence IYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESS.
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne ACTH Mouse, Clone: 57, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	P01189
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Antigen	ACTH
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A purified
Dilution	Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1.0ug/ml
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	PBS with 0.05% BSA. with 0.05% Sodium Azide
Immunogen	N-terminal fragment of human ACTH conjugated to KLH
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs).AIt also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Clone	57

Bio-Techne ACTH Antibody (CLIP/1449) - C-terminus, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability
Specifications

All Primary Antibodies

Content And Storage	Store at 4C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),SDS-Page
Form	Purified
Isotype	IgG1
Research Discipline	Neuroscience, Nutrient Sensing in the Brain
Concentration	0.2 mg/mL
Antigen	Beta-endorphin
Gene Symbols	POMC
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Flow Cytometry 0.5 - 1 ug/million cells, ELISA 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1 - 2 ug/ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, SDS-Page
Gene Alias	ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene ID (Entrez)	5443
Formulation	10mM PBS with 0.05% BSA with 0.05% Sodium Azide
Immunogen	Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CLIP/1449

Narrow Results

Search results for "iba+stimulation+peptide"

Filtered Search Results