Search results for "iba+stimulation+peptide"
There were no precise results for "iba+stimulation+peptide". Showing all possible results.
1
–
15
of
128
results

IBA Lifesciences Strep-Tactin™XT 4Flow™ Starter Kit
Strep-Tactin™XT 4Flow™ Starter Kit contains all reagents required for purification and detection of Strep-tagII™ and Twin-Strep-tag™ fusion proteins
IBA Lifesciences 1x Buffer XT-R - Regeneration Buffer
Buffer XT-R is a Strep-Tactin™XT regeneration buffer with magnesium chloride
Antigen | CREG2 |
---|---|
Gene Symbols | CREG2 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 32 kDa |
Gene Alias | cellular repressor of E1A-stimulated genes 2 |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 200407 |
Immunogen | Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH. |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q9BX79 |
Antigen | STRA6 |
Gene Symbols | STRA6 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 73 kDa |
Gene Alias | FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog |
Gene ID (Entrez) | 64220 |
Immunogen | Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_612358 |
Antigen | TP53I13 |
Gene Symbols | TP53I13 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 42 kDa |
Gene Alias | DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13 |
Gene ID (Entrez) | 90313 |
Immunogen | Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Bio-Techne Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Bio-Techne ACTH Antibody (CLIP/1407) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Immunohistochemistry (Paraffin),Immunofluorescence,CyTOF |
Form | Purified |
Isotype | IgG |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Concentration | 1.0 mg/mL |
Antigen | ACTH |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Flow Cytometry : 0.5-1ug/million cells, ELISA, Immunohistochemistry-Paraffin : 0.5-1ug/ml, Immunofluorescence : 1-2ug/ml, CyTOF-ready |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | PBS with No Preservative |
Immunogen | Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. |
Clone | CLIP/1407 |
Bio-Techne Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunohistochemistry (Paraffin),SDS-Page,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P01189 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Antigen | ACTH |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Flow Cytometry 0.5-1ug/million cells, Immunohistochemistry-Paraffin 0.5-1ug/ml, SDS-Page, Immunofluorescence 1-2ug/ml |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | 10mM PBS and 0.05% BSA with 0.05% Sodium Azide |
Immunogen | Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to CLIP (aa25-39 of ACTH); does not react with Synacthen (aa1-24 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. |
Clone | CLIP/1407 |
Content And Storage | Store at 4C. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P01189 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Antigen | ACTH |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | PBS with 0.05% BSA. with 0.05% Sodium Azide |
Immunogen | Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. |
Clone | AH26 + 57 |
Content And Storage | Store at 4C. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG1 Îş |
Gene Accession No. | P01189 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Antigen | ACTH |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 1-2ug/ml, Immunohistochemistry-Paraffin 0.5-1.0ug/ml |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | PBS with 0.05% BSA. with 0.05% Sodium Azide |
Immunogen | Synthetic peptide corresponding to aa1-24 of human ACTH |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. |
Clone | SPM333 |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q7Z7C7 |
Antigen | STRA8 |
Gene Symbols | STRA8 |
Regulatory Status | RUO |
Dilution | Western Blot 1.0 ug/ml |
Molecular Weight of Antigen | 37 kDa |
Gene Alias | stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog |
Gene ID (Entrez) | 346673 |
Formulation | PBS and 2% Sucrose with 0.09% Sodium Azide |
Immunogen | The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4C. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG1 Îş |
Gene Accession No. | P01189 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Antigen | ACTH |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1.0ug/ml |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | PBS with 0.05% BSA. with 0.05% Sodium Azide |
Immunogen | N-terminal fragment of human ACTH conjugated to KLH |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs).AIt also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. |
Clone | 57 |
Bio-Techne Beta-endorphin Mouse anti-Human, Clone-CLIP/1449, Novus Biologicals™
Mouse Monoclonal Antibody
Content And Storage | Store at -20 to -80C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),CyTOF |
Isotype | IgG1 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Concentration | 1 mg/mL |
Antigen | Beta-endorphin |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Flow Cytometry 0.5 - 1 ug/million cells, ELISA 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1 - 2 ug/ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, CyTOF-ready |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | PBS with No Preservative |
Immunogen | Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | CLIP/1449 |
Content And Storage | Store at 4C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),SDS-Page |
Form | Purified |
Isotype | IgG1 |
Research Discipline | Neuroscience, Nutrient Sensing in the Brain |
Concentration | 0.2 mg/mL |
Antigen | Beta-endorphin |
Gene Symbols | POMC |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Flow Cytometry 0.5 - 1 ug/million cells, ELISA 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1 - 2 ug/ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, SDS-Page |
Gene Alias | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
Gene ID (Entrez) | 5443 |
Formulation | 10mM PBS with 0.05% BSA with 0.05% Sodium Azide |
Immunogen | Synthetic peptide corresponding to aa25-39 of human ACTH (NGAEDESAEAFPLEF) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | CLIP/1449 |