Filtered Search Results
Search results for "protein concentrators.html"
Thermo Scientific™ Pierce™ Protein Concentrators PES, 10K MWCO, 0.5–100 mL
Thermo Scientific Pierce Protein Concentrators PES are easy-to-use centrifugal devices that provide fast processing and excellent recovery of proteins with MWCO values of 10K, available in 0.5–100 mL sample volumes.
Shipping Condition | Room Temperature |
---|---|
MWCO | 10 kDa |
Content And Storage | Store at room temperature. |
Material (Membrane) | PES |
Purification Target | Protein |
Thermo Scientific™ Pierce™ Protein Concentrators PES, 30K MWCO
Thermo Scientific Pierce Protein Concentrators PES are easy-to-use centrifugal devices that provide fast processing and excellent recovery of proteins over 30 KDa, in sample volumes from 0.5 to 100 mL.
Shipping Condition | Room Temperature |
---|---|
Disposable | Single-use |
MWCO | 30 kDa |
Material (Membrane) | PES |
Purification Target | Protein |
Components | Protein (N x 6.25) 92%, Moisture 6%, Ash 4.1%, Fat (PE extract) 0.8%, Fiber (crude) 0.25%, Calcium 0.15%, Phosphorus 0.8%, Sodium 1.3%, Potassium 0.05%, Particle Size 90% through 100 mesh, pH (water slurry) 7.1, Standard Plate Count <10000/g, Salmonella Ne gative, Yeast-Mold <100/g, Trypsin Inhibitor 4.9 to 7.3 mg/g protein |
---|---|
Format | Powder |
Product Type | Animal Diet |
Storage Requirements | 15°C to 30°C |
For Use With (Application) | Soy Protein isolated used in preparing animal research diets |
Thermo Scientific™ Pierce™ Bradford Plus Protein Assay Reagent
Brown-to-purple (A595nm), ready-to-use, fast reducing agent-compatible assay reagent to measure total protein concentration vs. protein standard.
Eppendorf™ Polypropylene Protein LoBind Microcentrifuge Tube
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Store peptide, antibody or virus samples in these LoBind microcentrifuge tubes. Eppendorf™ Polypropylene Protein LoBind Microcentrifuge Tubes are ideal for work in protein research, mass spectrometry and protein array sample preparation.
Material | Polypropylene |
---|---|
No. per Pack | 100 Tubes (2 bags of 50) |
For Use With (Application) | Protein LoBind consumables are best suited for work in protein research, mass spectrometry, protein array sample preparation, and storage of peptide, antibody or virus samples |
Sterility | PCR Clean |
Closure Material | Polypropylene |
Shipping Condition | Wet Ice |
---|---|
Workflow Step | Calibration |
Form | Powder |
Product Type | Intact Protein Standard Mix |
For Use With (Equipment) | Mass Spectrometer |
Product Line | Pierce™ |
Novus Biologicals™ Tau Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Thermo Scientific™ NAb™ Protein G Spin Columns, 1 mL
Affinity purify antibodies (IgG) with immobilized recombinant Protein G agarose offered in bottles, spin columns, filter plates and complete purification kits.
enQuireBio™ Recombinant Human MOG Protein
A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.
Buffer | The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride. |
---|---|
Regulatory Status | Research Use Only |
Purity or Quality Grade | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Product Type | Recombinant Protein |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Sequence | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |
Cross Reactivity | Human |
Protein Tag | His |
Species | E. coli |
Name | MOG Protein |
Purity or Quality Grade | >90%, by SDS-PAGE |
---|---|
Gene Alias | ALXDRD, FLJ45472, GFAP, GFAP astrocytes, glial fibrillary acidic protein |
Molecular Weight (g/mol) | 37.9 kDa |
Gene ID (Entrez) | 2670 |
Formulation | Lyophilized from 16 mM NaHCO3, containing 0.05% CHAPS and 0.05% Tween 20 |
Gene Symbol | GFAP |
Reconstitution | It is recommended to reconstitute this product with deionized water to its initial concentration. |
Storage Requirements | Store at -70°C. Avoid freeze-thaw cycles. |
Protein | GFAP |
enQuireBio™ Recombinant Human DNA replication complex GINS protein PSF2 Protein
A DNA sequence encoding the Homo sapiens (Human) DNA replication complex GINS protein PSF2, was expressed in the hosts and tags indicated.
Buffer | Tris-based buffer, 50% glycerol |
---|---|
Purity or Quality Grade | Greater than 90% as determined by SDS-PAGE. |
Gene Symbol | GINS2 |
Endotoxin Concentration | Not determined. |
Sequence | MDAAEVEFLA EKELVTIIPN FSLDKIYLIG GDLGPFNPGL PVEVPLWLAI NLKQRQKCRL LPPEWMDVEK LEKMRDHERK EETFTPMPSP YYMELTKLLL NHASDNIPKA DEIRTLVKDM WDTRIAKLRV SADSFVRQQE AHAKLDNLTL MEINTSGTFL TQALNHMYKL RTNLQPLEST QSQDF |
Name | DNA replication complex GINS protein PSF2 Protein |
Accession Number | NP_057179.1 |
Regulatory Status | Research Use Only |
Product Type | Recombinant Protein |
Protein Length | Full Length |
Gene ID (Entrez) | 51659 |
Cross Reactivity | Human |
Protein Tag | His-SUMO |
Species | E. coli |
Novus Biologicals™ MBP Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Novus Biologicals™ Synaptophysin Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition