missing translation for 'onlineSavingsMsg'
Learn More

RUN and FYVE domain containing 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RUFY1.

Brand: Abnova H00080230-A01.50uL

Product Code. 16160217

Quantity

Estimated Shipment: 12-12-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: ITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQV

Specifications

Antigen	RUN and FYVE domain containing 1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant RUFY1.
Gene	RUFY1
Gene Alias	FLJ22251/RABIP4/ZFYVE12
Host Species	Mouse
Quantity	50 μL
Research Discipline	Ubiquitin/Proteasome
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_025158
Gene Symbols	RUFY1
Immunogen	RUFY1 (NP_079434, 376 a.a. ∼ 474 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	80230
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Description