missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase VA/CA5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP1-68889
This item is not returnable.
View return policy
Description
Carbonic Anhydrase VA/CA5A Polyclonal specifically detects Carbonic Anhydrase VA/CA5A in Human samples. It is validated for Western Blot.
Specifications
| Carbonic Anhydrase VA/CA5A | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1 | |
| Rabbit | |
| 34 kDa | |
| 100 μL | |
| Lipid and Metabolism | |
| 763 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P35218 | |
| CA5A | |
| Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Carbonic Anhydrase VA/CA5A Antibody, Novus Biologicals™ > 100μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction