missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DSCAM Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
383.00€ - 611.00€
Specifications
| Antigen | DSCAM |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18336692
|
Bio-Techne
NBP3-17835-25UL |
25 μg |
383.00€
25µL |
Estimated Shipment: 30-01-2025
Log in to see stock. |
|||||
|
18392605
|
Bio-Techne
NBP3-17835-100UL |
100 μg |
611.00€
100µL |
Estimated Shipment: 30-01-2025
Log in to see stock. |
|||||
Description
DSCAM Polyclonal antibody specifically detects DSCAM in Human samples. It is validated for ImmunofluorescenceSpecifications
| DSCAM | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CHD2-42, CHD2-52, Down syndrome cell adhesion molecule, human CHD2-52 down syndrome cell adhesion molecule, 10CHD2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 1826 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title