missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUXA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP2-32452
This item is not returnable.
View return policy
Description
DUXA Polyclonal specifically detects DUXA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DUXA | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| double homeobox A, double homeobox protein A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 503835 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DUXA | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRI | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
DUXA Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
