missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
453.55€
Specifications
Antigen | GMPS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.Specifications
GMPS | |
Polyclonal | |
Rabbit | |
P49915 | |
8833 | |
Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
GMPS | |
IgG | |
77 kDa |