missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAML3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09240-100UL
This item is not returnable.
View return policy
Description
MAML3 Polyclonal specifically detects MAML3 in Human samples. It is validated for Western Blot.Specifications
MAML3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CAG/CTG 3, ERDA3, MAM-2, mam-3, mastermind-like 3 (Drosophila), mastermind-like protein 3, polyglutamine rich, trinucleotide repeat containing 3 | |
The immunogen is a synthetic peptide directed towards the middle region of human MAML3 (NP_061187). Peptide sequence YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG | |
100 μg | |
Neuroscience | |
55534 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction