missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ MBP Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-56185PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBP. Source: E.coli Amino Acid Sequence: ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP The MBP Recombinant Protein Antigen is derived from E. coli. The MBP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 4155 | |
| MBP Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| MBP | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50615. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only.