missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Melanoma Antigen Family B16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17167-25UL
This item is not returnable.
View return policy
Description
Melanoma Antigen Family B16 Polyclonal antibody specifically detects Melanoma Antigen Family B16 in Human samples. It is validated for Immunofluorescence
Specifications
Melanoma Antigen Family B16 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 ÎĽg/mL | |
MAGEB16, MAGE-B16 Antigen, Melanoma Antigen Family B, 16, Melanoma Antigen Family B, 16 (Pseudogene), Melanoma-Associated Antigen B16 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK | |
25 ÎĽg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
139604 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Melanoma Antigen Family B16 Rabbit anti-Human, Polyclonal, Novus Biologicals™ > 25 μg; Unconjugated
Spot an opportunity for improvement?Share a Content Correction