missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ MMS19 like protein Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand: Novus Biologicals™ NBP2-55388PEP

Product Code. 18247124

259.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMS19 like protein. Source: E.coli Amino Acid Sequence: LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA The MMS19 like protein Recombinant Protein Antigen is derived from E. coli. The MMS19 like protein Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez)	64210
Common Name	MMS19 like protein Recombinant Protein Antigen
Formulation	PBS and 1M Urea, pH 7.4
Gene Alias	FLJ34167, MET18, MET18 homolog, MMS19 nucleotide excision repair homolog (S. cerevisiae), S. cerevisiae)
Label Type	Unlabeled
Quantity	100 μL
Source	E.coli

Purification Method	>80% by SDS-PAGE and Coomassie blue staining
Content And Storage	Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)	Blocking/Neutralizing, Control
Gene Symbol	MMS19
Product Type	Recombinant Protein Antigen
Regulatory Status	RUO
Specific Reactivity	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51748. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 10218823

BD Difco ™ Adjuvants BD Difco ™ Adjuvants

620,00 € / 600mg
Catalog No. 17338583

MP Biomedicals ™ Poly-L-Lysine Hydrochloride MP Biomedicals ™ Poly-L-Lysine Hydrochloride

463,00 € / 100mg

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Novus Biologicals™ MMS19 like protein Recombinant Protein Antigen > Quantity: 100μL

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For research use only.

Spot an opportunity for improvement?Share a Content Correction

Novus Biologicals™ MMS19 like protein Recombinant Protein Antigen

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show