missing translation for 'onlineSavingsMsg'
Learn More

PEPD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP1-86072

489.25 EUR valid until 2025-12-31
Use promo code "24272" to get your promotional price.

Product Code. 18293287

515.00€ / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PEPD Polyclonal specifically detects PEPD in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	PEPD
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias	aminoacyl-L-proline hydrolase, EC 3.4.13.9, Imidodipeptidase, MGC10905, peptidase Dimidodipeptidase, PRD, PROLIDASE, Proline dipeptidase, xaa-Pro dipeptidase, X-Pro dipeptidase
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	PEPD
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:ITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDE
Quantity	0.1 mL
Research Discipline	metabolism
Gene ID (Entrez)	5184
Target Species	Human, Mouse, Rat
Isotype	IgG

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

PEPD Antibody, Novus Biologicals™ > 0.1mL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

PEPD Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show