missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Protein Kinase D2 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP1-84139PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKD2. The Protein Kinase D2 Recombinant Protein Antigen is derived from E. coli. The Protein Kinase D2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-84139. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
| 25865 | |
| Chromatography | |
| 0.5mg/mL | |
| PBS and 1M Urea, pH 7.4. | |
| PRKD2 | |
| 25kDa | |
| 0.1mL | |
| Cancer, Protein Kinase, Signal Transduction, Tumor Suppressors | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84139. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Human | |
| >80% | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| Unlabeled | |
| Protein Kinase D2 | |
| RUO | |
| E.Coli | |
| QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL |
For Research Use Only