missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF3A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
459.00€
Specifications
Antigen | SF3A2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SF3A2 Polyclonal specifically detects SF3A2 in Human samples. It is validated for Western Blot.Specifications
SF3A2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
pre-mRNA splicing factor SF3A, subunit 2, PRP11, PRPF11, SAP 62, SAP62Prp11, SF3a66splicing factor 3a, subunit 2, 66kD, spliceosome associated protein 62, Spliceosome-associated protein 62, splicing factor 3A subunit 2, splicing factor 3a, subunit 2, 66kDa | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SF3A2. Peptide sequence GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
8175 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title