missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APEG1 Recombinant Protein

Brand: Abnova™ H00010290-P01.25ug

View more versions of this product

Product Code. 16104842

521.00€ / 25µg

Quantity

Estimated Shipment: 30-01-2025
to see stock.

Add to basket

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH06346
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	38.17
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 μg
Immunogen	MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Gene Alias	APEG1/BPEG/KIAA1297/MGC12676/SPEGalpha/SPEGbeta
Gene Symbol	SPEG
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10290
Name	APEG1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SPEG
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ APEG1 Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers