Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1 – 15 of 53,135 results

Abnova™ DCP2 Recombinant Protein

Pricing and Availability
Specifications

Form	Solution
pH Range	8
Common Name	DCP2
Molecular Weight (g/mol)	68.09
Gene Symbol	DCP2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Source	Wheat Germ (in vitro)
Name	DCP2 (Human) Recombinant Protein (P01)
Accession Number	AAH64593
Purification Method	Glutathione Sepharose 4 Fast Flow
Preparation Method	In vitro wheat germ expression system
Gene Alias	FLJ33245/NUDT20
Gene ID (Entrez)	167227
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Immunogen	METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Cross Reactivity	Human
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human TLR2 Partial ORF (AAH33756.1, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability
Specifications

Form	Liquid
Common Name	TLR2
Molecular Weight (g/mol)	36.63kDa
Gene Symbol	TLR2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	TLR2 (Human) Recombinant Protein (Q01)
Accession Number	AAH33756.1
Regulatory Status	RUO
Gene Alias	CD282/TIL4
Gene ID (Entrez)	7097
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Corning™ Laminin, Mouse

Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth

Pricing and Availability

Thermo Scientific™ Pierce™ Bovine Serum Albumin, Biotinylated

Purified biotin and biotinylated BSA, HRP, AP or FITC for use as controls or to amplify signal in IHC via the avidin-biotin complex (ABC).

Promotions are available

Pricing and Availability

Corning™ Ultrapure Laminin, Mouse

Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth

Pricing and Availability

Thermo Scientific™ VitroEase™ Apoferritin Standard

The Thermo Scientific™ VitroEase™ Apoferritin Standard is a highly validated pure protein for use as a quality control sample for cryo-electron microscopy single particle analysis.

Promotions are available

Pricing and Availability

R&D Systems™ Recombinant Human IFN-alpha I (alpha 17) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity