missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDK1
PDK1
Brand: Thermo Scientific P3001
This item is not returnable.
View return policy
Description
PDK1 (3-phosphoinositide dependent kinase-1) is a serine⁄threonine protein kinase localized to the plasma membrane. It plays a vital role in insulin-induced glycogen synthesis, PKC activation, and activation of the AGC subfamily of protein kinases.
Specifications
| NP_002604 | |
| Pharma and Biopharma, Protein Assays and Analysis, Target and Lead Identification and Validation, Kinase Assay | |
| 66.9kDa | |
| 7.5 | |
| –80°C | |
| 1 Each | |
| PDK1 | |
| PDHK | |
| 184nmoles of phosphate transferred to PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) per minute per mg of total protein at 30°C. Activity determined at a final protein concentration of 1μg/mL | |
| His Tag | |
| Kinase and inhibitors | |
| 70% by SDS-PAGE |
| 0.2mg/mL | |
| 5163, 5170 | |
| PDK1 | |
| 5 μg | |
| For research use only. Not for use in diagnostic procedures | |
| PDK-1 | |
| PDK1 was pre-diluted in enzyme dilution buffer and assayed in 50mM Tris (pH 7.5), 15mM MgCl2, 2.5mM DTT, 5mM EGTA, 200μM ATP, 100μM PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) and trace [32P]-γ-ATP for 10 minutes at 30°C | |
| PDK1 | |
| Human | |
| Baculovirus | |
| Serine/threonine kinase |
For Research Use Only. Not for use in diagnostic procedures.