missing translation for 'onlineSavingsMsg'
Learn More

PDK1

Brand: Thermo Scientific P3001

Product Code. 10591194

520.00€ / 1mg

Quantity

Estimated Shipment: 20-01-2025
to see stock.

Add to basket

This item is not returnable. View return policy

Description

PDK1 (3-phosphoinositide dependent kinase-1) is a serine⁄threonine protein kinase localized to the plasma membrane. It plays a vital role in insulin-induced glycogen synthesis, PKC activation, and activation of the AGC subfamily of protein kinases.

Specifications

Accession Number	NP_002604
For Use With (Application)	Pharma and Biopharma, Protein Assays and Analysis, Target and Lead Identification and Validation, Kinase Assay
Molecular Weight (g/mol)	66.9kDa
pH Range	7.5
Storage Requirements	–80°C
Packaging	1 Each
Common Name	PDK1
KinaseFamily	PDHK
Specific Reactivity	184nmoles of phosphate transferred to PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) per minute per mg of total protein at 30°C. Activity determined at a final protein concentration of 1μg/mL
Protein Tag	His Tag
Protein Family	Kinase and inhibitors
Purity or Quality Grade	70% by SDS-PAGE

Concentration	0.2mg/mL
Gene ID (Entrez)	5163, 5170
Name	PDK1
Quantity	5 μg
Regulatory Status	For research use only. Not for use in diagnostic procedures
Gene Alias	PDK-1
Assays	PDK1 was pre-diluted in enzyme dilution buffer and assayed in 50mM Tris (pH 7.5), 15mM MgCl2, 2.5mM DTT, 5mM EGTA, 200μM ATP, 100μM PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) and trace [32P]-γ-ATP for 10 minutes at 30°C
Product Type	PDK1
Species	Human
Expression System	Baculovirus
Protein Subtype	Serine/threonine kinase

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only. Not for use in diagnostic procedures.

Spot an opportunity for improvement?Share a Content Correction

PDK1

Description

Specifications

Product Suggestions

Documents

Special Offers