missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARF6 (Human) Recombinant Protein

Human ARF6 full-length ORF ( AAH08918, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	AAH08918
Gene ID (Entrez)	382
Name	ADP-ribosylation factor 6
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16191801 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000382-P01.10ug	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 14-10-2024 Log in to see stock.	Add to basket

16101811 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000382-P01.25ug	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 14-10-2024 Log in to see stock.	Add to basket

Description

Sequence: MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Specifications

Accession Number	AAH08918
Name	ADP-ribosylation factor 6
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	DKFZp564M0264
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	382
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	ARF6
Protein Tag	GST

Safety and Handling

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Description