missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CETN2 (Human) Recombinant Protein
Human CETN2 full-length ORF ( AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001069-P01.10ug
This item is not returnable.
View return policy
Description
- Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Specifications
AAH05334 | |
centrin, EF-hand protein, 2 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CETN2 | |
GST |
1069 | |
Wheat germ expression system | |
10 μg | |
CALT, CEN2 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction