missing translation for 'onlineSavingsMsg'
Learn More

CPS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP1-54775

386.40 EUR valid until 2025-03-28
Use promo code "25306" to get your promotional price.

View more versions of this product

Product Code. 18263261

483.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CPS1 Polyclonal specifically detects CPS1 in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CPS1
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16
Host Species	Rabbit
Molecular Weight of Antigen	165 kDa
Quantity	100 μL
Primary or Secondary	Primary
Test Specificity	Yeast: 77%.
Target Species	Human, Pig, Rat, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Yeast
Form	Purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration	1 mg/ml
Dilution	Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.	P31327
Gene Symbols	CPS1
Immunogen	Synthetic peptides corresponding to CPS1(carbamoyl-phosphate synthetase 1, mitochondrial) The peptide sequence was selected from the middle region of CPS1. Peptide sequence YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI.
Purification Method	Protein A purified
Regulatory Status	RUO
Gene ID (Entrez)	1373
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

CPS1 Antibody, Novus Biologicals™ > 100 ul; Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CPS1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show