missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
393.00€ - 598.00€
Specifications
Accession Number | AAB37352 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
Source | Wheat Germ (in vitro) |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16141044
|
Abnova™
P0001.10ug |
10 μg |
393.00€
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
16151044
|
Abnova™
P0001.25ug |
25 μg |
598.00€
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Specifications
AAB37352 | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
Wheat Germ (in vitro) | |
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
Antibody Production, Protein Array, ELISA, Western Blot | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C Aliquot to avoid repeated freezing and thawing | |
Human |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ GST Protein