missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NHP2L1 Full-length ORF (NP_001003796.1, 1 a.a. - 128 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_001003796.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 4809 |
| Molecular Weight (g/mol) | 40.6kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16110758
|
Abnova™
H00004809-P01.25ug |
25 ug |
508.00€
25µg |
Estimated Shipment: 14-10-2024
Log in to see stock. |
|||||
|
16100758
|
Abnova™
H00004809-P01.10ug |
10 ug |
335.00€
10µg |
Estimated Shipment: 14-10-2024
Log in to see stock. |
|||||
Description
Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLVSpecifications
| NP_001003796.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 40.6kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV | |
| RUO | |
| NHP2L1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 4809 | |
| NHP2L1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 15.5K/FA-1/FA1/NHPX/OTK27/SNRNP15-5/SNU13/SPAG12/SSFA1 | |
| NHP2L1 | |
| Recombinant | |
| wheat germ expression system |