missing translation for 'onlineSavingsMsg'
Learn More

Print

Abnova™ Human NISCH Partial ORF (AAH56900, 1246 a.a. - 1345 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Specifications

Accession Number	AAH56900
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	11188
Molecular Weight (g/mol)	36.74kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16106342 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00011188-Q01.25ug	25 ug	N/A View alternative products Save Up to »	N/A

16196332 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00011188-Q01.10ug	10 ug	N/A View alternative products Save Up to »	N/A

Description

Description

Sequence: LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTFTVAQKMAEPEKAPAL

Specifications

Specifications

Accession Number	AAH56900
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	FLJ14425/FLJ40413/FLJ90519/I-1/IRAS/KIAA0975
Gene Symbol	NISCH
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	11188
Name	NISCH (Human) Recombinant Protein (Q01)
Immunogen	LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTFTVAQKMAEPEKAPAL
Regulatory Status	RUO
Common Name	NISCH
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Back to Top