missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MAGEA11 (Human) Recombinant Protein
Human MAGEA11 full-length ORF ( AAH04479.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00004110-P01.10ug
This item is not returnable.
View return policy
Description
- Sequence: MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
Specifications
AAH04479.1 | |
melanoma antigen family A, 11 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MAGEA11 | |
GST |
4110 | |
Wheat germ expression system | |
10 μg | |
MAGE-11, MAGE11, MAGEA-11, MGC10511 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction