missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NCR1 Recombinant Protein
Brand: Abnova™ H00009437-P01.25ug
This item is not returnable.
View return policy
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH64806 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
56.76 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 μg | |
QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL | |
CD335/LY94/NK-p46/NKP46 | |
NCR1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
9437 | |
NCR1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NCR1 | |
Human | |
Recombinant | |
Solution |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction