missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human CRABP2 Protein
Highly purified. Generating reliable and reproducible results.
Brand: Novus Biologicals™ NBC1-18490
This item is not returnable.
View return policy
Description
An un-tagged recombinant protein corresponding to the amino acids1-138 of Human E.coli CRABP2 The Recombinant Human CRABP2 Protein is derived from E. coli. The Recombinant Human CRABP2 Protein has been validated for the following applications: SDS-Page.
Specifications
NP_001869 | |
SDS-PAGE | |
1382 | |
CRABP2 Protein | |
0.1 mg | |
Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.) | |
CRABP2 | |
Core ESC Like Genes, Neuroscience, Stem Cell Markers | |
CRABP2 |
1 mg/mL | |
20 mM Tris-HCl buffer (pH 8.0), 20% glycerol | |
M.W. (theoretical): 15.6 kDa | |
Protein | |
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE | |
<1.0 EU / 1 μg of protein (determined by LAL method) | |
Human | |
>95%, by SDS-PAGE |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Novus Biologicals™ Recombinant Human CRABP2 Protein > 0.1mg; Unlabeled
Spot an opportunity for improvement?Share a Content Correction