missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ OIP5 Recombinant Protein

Brand: Abnova™ H00011339-P01.25ug

Product Code. 16106582

Quantity

Estimated Shipment: 10-12-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH15050
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	51.3
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 μg
Immunogen	MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Gene Alias	5730547N13Rik/LINT-25/MIS18beta
Gene Symbol	OIP5
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	11339
Name	OIP5 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	OIP5
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description