missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PSIP1 Recombinant Protein
344.00€ - 521.00€
Specifications
| Accession Number | AAH33817 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gene ID (Entrez) | 11168 |
| Molecular Weight (g/mol) | 31.13 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16196302
|
Abnova™
H00011168-P01.10ug |
10 ÎĽg |
344.00€
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16106312
|
Abnova™
H00011168-P01.25ug |
25 ÎĽg |
521.00€
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH33817 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 31.13 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PSIP1 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 11168 | |
| PSIP1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET | |
| DFS70/LEDGF/MGC74712/PAIP/PSIP2/p52/p75 | |
| PSIP1 | |
| Wheat Germ (in vitro) | |
| GST |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ PSIP1 Recombinant Protein