missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human MOG Protein

A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.

Brand: enQuireBio™ QP12718-50ug

Product Code. 15911329

Quantity

Estimated Shipment: 15-01-2025
to see stock.

Add to basket

This item is not returnable. View return policy

Specifications

Name	MOG Protein
Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Purity or Quality Grade	Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Quantity	50 μg
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	Human
Protein Tag	His
Buffer	The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.

Product Suggestions

Description