missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STAT5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81051-25ul
This item is not returnable.
View return policy
Description
STAT5A Polyclonal antibody specifically detects STAT5A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| STAT5A | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P42229 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| MGF, signal transducer and activator of transcription 5A, STAT5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS | |
| 25 μL | |
| Cancer, Phospho Specific, Signal Transduction, Transcription Factors and Regulators | |
| 6776 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |