missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STAT5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
353.12€ - 484.87€
Specifications
| Antigen | STAT5A |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18470681
|
Novus Biologicals
NBP1-81051 |
0.1 mL |
484.87€
0.10mL |
Estimated Shipment: 05-11-2024
Log in to see stock. |
|||||
|
18476640
|
Novus Biologicals
NBP1-81051-25ul |
25 μL |
353.12€
25µL |
Estimated Shipment: 05-11-2024
Log in to see stock. |
|||||
Description
STAT5A Polyclonal antibody specifically detects STAT5A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| STAT5A | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Phospho Specific, Signal Transduction, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol | |
| MGF, signal transducer and activator of transcription 5A, STAT5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| P42229 | |
| 6776 | |
| IgG | |
| Immunogen affinity purified |