accessibility menu, dialog, popup

Test

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

Show all

brands

  • (25)
  • (1)
  • (34)
  • (4,464)
  • (1,214)
  • (38,758)
  • (7)
  • (1)
  • (43)
  • (488)
  • (5)
  • (8)
  • (393)
  • (2)
  • (1)
  • (3)
  • (37,037)
  • (31)
  • (1)
  • (2)
  • (259)
  • (15)
  • (1)
  • (4)
  • (237)
  • (1)
  • (7)
  • (853)
  • (23,194)
  • (24)
  • (173)
  • (2)
  • (3)
  • (29)
  • (21)
  • (1)
  • (3)
  • (3)
  • (14)
  • (3)
  • (1)
  • (12)
  • (2)
  • (4)
  • (13)
  • (4)
  • (249)
  • (2)
  • (5)
  • (1)
  • (270)
  • (1)
  • (2)
  • (37)
  • (473)
  • (59)
  • (183)
  • (59)
  • (3)
  • (1)
  • (4)
  • (5)
  • (55)
  • (5,538)
  • (90)
  • (62)
  • (2)
  • (1)
  • (5)
  • (1)
  • (40,874)
  • (134)
  • (1,684)
  • (2)
  • (3)
  • (1,168)
  • (35)
  • (9)
  • (1)
  • (9,386)
  • (2,657)
  • (35)
  • (3)
  • (1)
  • (1)
  • (184)
  • (47)
  • (4)
  • (1)
  • (13)
  • (1)
  • (5)
  • (359)
  • (2)
  • (12)
  • (1,213)
  • (1,675)
  • (92)
  • (98)
  • (220)
  • (1)
  • (2)
  • (1)
  • (8)
  • (2)
  • (536)
  • (35)
  • (2,258)
  • (232)
  • (22)
  • (5)
  • (4)
  • (6)
  • (10,594)

special offers

  • (3)
  • (3)
  • (2,391)
  • (396)

special programs

  • (37)
  • (280)
  • (110)

Species

  • (2)
  • (12)
  • (1,857)
  • (106)
  • (1)
  • (2)
  • (62)
Show all

For Use With (Application)

  • (3)
  • (2,128)
  • (1)
  • (28,535)
  • (4)
  • (65)
  • (4,588)
Show all

Form

  • (4)
  • (4)
  • (26)
  • (13)
  • (25)
  • (4)
  • (1)
Show all

Recombinant

  • (18)
  • (38,232)
  • (580)

Conjugate

  • (2)
  • (3)
  • (2)
  • (507)
  • (6)
  • (1)
  • (12)
Show all

Host Species

  • (1)
  • (3)
  • (14)
  • (2)
  • (135)
  • (9)
  • (1)
Show all

Quantity

  • (26)
  • (4)
  • (23)
  • (51)
  • (9)
  • (46)
  • (1)
Show all

Gene ID (Entrez)

  • (1)
  • (2)
  • (1)
  • (2)
  • (2)
  • (1)
  • (2)
Show all

Target Species

  • (4)
  • (2)
  • (2)
  • (40)
  • (132)
  • (17)
  • (2)
Show all

Applications

  • (6)
  • (15)
  • (2)
  • (503)
  • (1)
  • (27)
  • (13)
Show all

Search results for "protein"

1 – 15 of 148,430 results
1

Thermo Scientific™ Pierce™ Bradford Plus Protein Assay Reagent

Brown-to-purple (A595nm), ready-to-use, fast reducing agent-compatible assay reagent to measure total protein concentration vs. protein standard.

3

Thermo Scientific™ Pierce™ BCA Protein Assay Kit - Reducing Agent Compatible

Reducing agent-compatible version of our popular BCA Reagent Kit to measure protein concentration in samples containing DTT or BME thiol-reductants.

Promotions are available
4

Thermo Scientific™ Pierce™ Protein Concentrators PES, 10K MWCO, 0.5–100 mL

Thermo Scientific Pierce Protein Concentrators PES are easy-to-use centrifugal devices that provide fast processing and excellent recovery of proteins with MWCO values of 10K, available in 0.5–100 mL sample volumes.

EDGE
Shipping Condition Room Temperature
MWCO 10 kDa
Content And Storage Store at room temperature.
Material (Membrane) PES
Purification Target Protein
5

Thermo Scientific™ Pierce™ Intact Protein Standard Mix

Shipping Condition Wet Ice
Workflow Step Calibration
Form Powder
Product Type Intact Protein Standard Mix
For Use With (Equipment) Mass Spectrometer
Product Line Pierce™
6

enQuireBio™ Recombinant Human MOG Protein

A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.

Buffer The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.
Regulatory Status Research Use Only
Purity or Quality Grade Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Product Type Recombinant Protein
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Sequence MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Cross Reactivity Human
Protein Tag His
Species E. coli
Name MOG Protein
7

Novus Biologicals™ Recombinant Human GFAP Protein

Purity or Quality Grade >90%, by SDS-PAGE
Gene Alias ALXDRD, FLJ45472, GFAP, GFAP astrocytes, glial fibrillary acidic protein
Molecular Weight (g/mol) 37.9 kDa
Gene ID (Entrez) 2670
Formulation Lyophilized from 16 mM NaHCO3, containing 0.05% CHAPS and 0.05% Tween 20
Gene Symbol GFAP
Reconstitution It is recommended to reconstitute this product with deionized water to its initial concentration.
Storage Requirements Store at -70°C. Avoid freeze-thaw cycles.
Protein GFAP
8

enQuireBio™ Recombinant Human DNA replication complex GINS protein PSF2 Protein

A DNA sequence encoding the Homo sapiens (Human) DNA replication complex GINS protein PSF2, was expressed in the hosts and tags indicated.

Buffer Tris-based buffer, 50% glycerol
Purity or Quality Grade Greater than 90% as determined by SDS-PAGE.
Gene Symbol GINS2
Endotoxin Concentration Not determined.
Sequence MDAAEVEFLA EKELVTIIPN FSLDKIYLIG GDLGPFNPGL PVEVPLWLAI NLKQRQKCRL LPPEWMDVEK LEKMRDHERK EETFTPMPSP YYMELTKLLL NHASDNIPKA DEIRTLVKDM WDTRIAKLRV SADSFVRQQE AHAKLDNLTL MEINTSGTFL TQALNHMYKL RTNLQPLEST QSQDF
Name DNA replication complex GINS protein PSF2 Protein
Accession Number NP_057179.1
Regulatory Status Research Use Only
Product Type Recombinant Protein
Protein Length Full Length
Gene ID (Entrez) 51659
Cross Reactivity Human
Protein Tag His-SUMO
Species E. coli
9

Novus Biologicals Recombinant Human Synaptophysin GST (N-Term) Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Major synaptic vesicle protein p38, MRX, MRXSYP, synaptophysin
Molecular Weight (g/mol) M.W. (Theoretical): 60.17 kDa
Gene ID (Entrez) 6855
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol SYP
Research Category Membrane Vesicle Markers, Stem Cell Markers
Inhibitor Properties Use in blocking/ neutralizing and IHC reported in scientific literature (PMID 24786752). Use in ELISA reported in scientific literature (PMID 23371365).
Storage Requirements Store at -80C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification,Block/Neutralize
Protein Synaptophysin
10

Novus Biologicals™ Recombinant Human Tau Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Western Blot, In vitro assay, In vivo assay, SDS-Page

Buffer 10 mM HEPES, 100 mM NaCl pH 7.4
Regulatory Status RUO
Purity or Quality Grade 0.2 Micrometer Filtered
Conjugate Unconjugated
Specific Reactivity Tau
Molecular Weight (g/mol) 15.1 kDa
Gene ID (Entrez) 4137
Gene Symbol MAPT
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,In vitro Assay,In vivo Assay,SDS-PAGE
Species Human
Source E. coli
Recombinant Recombinant
11

Novus Biologicals™ Recombinant Human DPAGT1 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias ALG7, CDG1J, CDG-Ij, D11S366, DGPTDPAGT2UAGT, dolichyl-phosphate (UDP-N-acetylglucosamine)N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P tra, dolichyl-phosphate (UDP-N-acetylglucosamine)N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), dolichyl-phosphate alpha-N-acetylglucosaminyltransferase, EC 2.7.8, EC 2.7.8.15, G1PT, GlcNAc-1-P transferase, GPTDPAGT, N-acetylglucosamine-1-phosphate transferase, UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase, UDP-N-acetylglucosamine--dolichyl-phosphateN-acetylglucosaminephosphotransferase, UGAT
Molecular Weight (g/mol) M.W. (Theoretical): 34.76 kDa
Gene ID (Entrez) 1798
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol DPAGT1
Research Category Signal Transduction
Storage Requirements Store at -80C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein DPAGT1
12

R&D Systems™ Recombinant Human Tau Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

13

Novus Biologicals™ Recombinant Human Tau 441 Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Western Blot, In vitro assay, In vivo assay, SDS-Page

Buffer 10 mM HEPES, 100 mM NaCl pH 7.4
Regulatory Status RUO
Purity or Quality Grade 0.2 Micrometer Filtered
Conjugate Unconjugated
Specific Reactivity Tau 441
Molecular Weight (g/mol) 45.8 kDa
Gene ID (Entrez) 4137
Gene Symbol MAPT
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,In vitro Assay,In vivo Assay,SDS-PAGE
Species Human
Source E. coli
Recombinant Recombinant
15

Novus Biologicals™ Recombinant Human Tau 441 Monomer Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Western Blot, In vitro assay, In vivo assay, SDS-Page

Buffer 10 mM HEPES, 100 mM NaCl pH 7.4
Regulatory Status RUO
Purity or Quality Grade 0.2 Micrometer Filtered
Conjugate Unconjugated
Specific Reactivity Tau 441
Molecular Weight (g/mol) 45.8 kDa
Gene ID (Entrez) 4137
Gene Symbol MAPT
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,In vitro Assay,In vivo Assay,SDS-PAGE
Species Human
Source E. coli
Recombinant Recombinant