Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1 – 15 of 53,139 results

Abnova™ GST Protein

GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.

Pricing and Availability
Specifications

Accession Number	AAB37352
Target Species Named	Human
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue
Sequence	MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Storage Requirements	Store at -80°C Aliquot to avoid repeated freezing and thawing
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Source	Wheat Germ (in vitro)

Form	Solution
pH Range	8
Common Name	PSIP1
Molecular Weight (g/mol)	31.13
Gene Symbol	PSIP1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Source	Wheat Germ (in vitro)
Name	PSIP1 (Human) Recombinant Protein (P01)
Accession Number	AAH33817
Purification Method	Glutathione Sepharose 4 Fast Flow
Preparation Method	In vitro wheat germ expression system
Gene Alias	DFS70/LEDGF/MGC74712/PAIP/PSIP2/p52/p75
Gene ID (Entrez)	11168
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Immunogen	MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Cross Reactivity	Human
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

enQuireBio™ Recombinant Human EPOR Protein

A cDNA sequence encoding the EPOR was constructed and used to recombinantly synthesize the protein.

Pricing and Availability
Specifications

Buffer	EPOR protein solution (0.5 mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Regulatory Status	Research Use Only
Purity or Quality Grade	Greater than 95.0% as determined by analysis by SDS-PAGE.
Product Type	Recombinant Protein
Biological Activity	Measured by its ability to inhibit EPO dependent proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect less or equal to 70ng/ml.
Gene ID (Entrez)	2057
Gene Symbol	EPOR
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Sequence	APPPNLPDPK FESKAALLAA RGPEELLCFT ERLEDLVCFW EEAASAGVGP GNYSFSYQLE DEPWKLCRLH QAPTARGAVR FWCSLPTADT SSFVPLELRV TAASGAPRYH RVIHINEVVL LDAPVGLVAR LADESGHVVL RWLPPPETPM TSHIRYEVDV SAGNGAGSVQ RVEILEGRTE CVLSNLRGRT RYTFAVRARM AEPSFGGFWS AWSEPVSLLT PSDLDPHHHH HH
Cross Reactivity	Human
Protein Tag	His
Species	Baculovirus
Name	EPOR Protein

Novus Biologicals™ Recombinant Protein A/G Protein

Recombinant Protein

Pricing and Availability

Novus Biologicals™ Recombinant Human CSK His Protein

Highly purified. Generating reliable and reproducible results.

Pricing and Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	C-Src kinase, c-src tyrosine kinase, EC 2.7.10, EC 2.7.10.2, MGC117393, Protein-tyrosine kinase CYL, tyrosine-protein kinase CSK
Common Name	CSK
Molecular Weight (g/mol)	TMW: 53.1kDa
Gene ID (Entrez)	1445
Formulation	Phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

R&D Systems™ Recombinant Mouse Wnt-9a Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	37 kDa
Gene ID (Entrez)	216795
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Chinese Hamster Ovary cell line,CHO-derived mouse Wnt-9a protein Tyr30-Gly365
Recombinant	Recombinant
Name	Wnt-9a

R&D Systems™ Recombinant Human PPA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

R&D Systems™ Recombinant S. cerevisiae PPA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

R&D Systems™ Recombinant Human NF-L Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

Novus Biologicals™ Recombinant Human CRABP2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing and Availability

R&D Systems™ Recombinant Human Nephrin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing and Availability

Novus Biologicals™ Recombinant Human FATP2/SLC27A2 GST (N-Term) Protein

Recombinant Protein

Pricing and Availability

Abnova™ Human EPOR Full-length ORF (NP_000112.1, 1 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability
Specifications

Form	Liquid
Common Name	EPOR
Molecular Weight (g/mol)	81.5kDa
Gene Symbol	EPOR
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	EPOR (Human) Recombinant Protein (P01)
Accession Number	NP_000112.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	MGC138358
Gene ID (Entrez)	2057
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SRC Full-length ORF (NP_005408.1, 1 a.a. - 536 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability
Specifications

Accession Number	NP_005408.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Form	Liquid
Common Name	SRC
Molecular Weight (g/mol)	86.2kDa
Gene ID (Entrez)	6714
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Symbol	SRC
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Expression System	wheat germ expression system
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SRC (NM_005417, 1 a.a. - 536 a.a.) Full-length Recombinant Protein with GST-His tag expressed in Sf9 cells

Used for Func, SDS-PAGE

Pricing and Availability

Prev
1
2
3
4
5
6
...
3,543
Next

Recombinant Proteins

Recombinant Proteins

Abnova™ GST Protein

Abnova™ PSIP1 Recombinant Protein

enQuireBio™ Recombinant Human EPOR Protein

Novus Biologicals™ Recombinant Protein A/G Protein

Novus Biologicals™ Recombinant Human CSK His Protein

R&D Systems™ Recombinant Mouse Wnt-9a Protein

R&D Systems™ Recombinant Human PPA1 Protein

R&D Systems™ Recombinant S. cerevisiae PPA1 Protein

R&D Systems™ Recombinant Human NF-L Protein

Novus Biologicals™ Recombinant Human CRABP2 Protein

R&D Systems™ Recombinant Human Nephrin Protein

Novus Biologicals™ Recombinant Human FATP2/SLC27A2 GST (N-Term) Protein

Abnova™ Human EPOR Full-length ORF (NP_000112.1, 1 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SRC Full-length ORF (NP_005408.1, 1 a.a. - 536 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SRC (NM_005417, 1 a.a. - 536 a.a.) Full-length Recombinant Protein with GST-His tag expressed in Sf9 cells

You recently viewed...Show

Filtered Search Results

Recombinant Proteins

Recombinant Proteins

Selected Filters

Narrow Results

Narrow Results

Filtered Search Results