missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SUB1 (Human) Recombinant Protein

Human SUB1 partial ORF ( AAH09610.1, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00010923-Q01.10ug

Product Code. 16185862

This item has been discontinued and is no longer available. View the product for possible alternatives or contact our Technical Support team on +351 21 425 33 50 for assistance
View alternative products »

This item is not returnable. View return policy

Description

Sequence: APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV

Specifications

Accession Number	AAH09610.1
Name	SUB1 homolog (S. cerevisiae)
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	SUB1
Protein Tag	GST

Gene ID (Entrez)	10923
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	MGC102747, P15, PC4, p14
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ SUB1 (Human) Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers