Antibodies

Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

1
–
15
of
1,762
results
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VI |
Gene Symbols | CA6 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
Gene ID (Entrez) | 765 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XII/CA12 |
Gene Symbols | CA12 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
Gene ID (Entrez) | 771 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VII/CA7 (Accession#: P43166; Met1-Ala264) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIV/CA14 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1 |
Gene ID (Entrez) | 23632 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase XIV/CA14 (Accession#: NP_035927.1; Met 1-Met 290) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism, Vision |
Antigen | Carbonic Anhydrase IV/CA4 |
Gene Symbols | CA4 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | CAIV, CA-IV, Car4, Carbonate dehydratase IV, carbonic anhydrase 4, carbonic anhydrase IVRP17, carbonic dehydratase IV, EC 4.2.1.1, retinitis pigmentosa 17 (autosomal dominant) |
Gene ID (Entrez) | 762 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XII/CA12 |
Gene Symbols | CA12 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot - Reported in (PMID: 26911677)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
Gene ID (Entrez) | 771 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIV/CA14 |
Gene Symbols | CA14 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1 |
Gene ID (Entrez) | 23632 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGIL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000 |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision |
Antigen | Carbonic Anhydrase IX/CA9 |
Gene Symbols | CA9 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Gene Alias | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
Gene ID (Entrez) | 768 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase XIII/CA13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIII/CA13 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 4-6 uL/mg of lysate |
Gene Alias | carbonic anhydrase 13, carbonic anhydrase XIIICarbonate dehydratase XIII, CAXIII, CA-XIII, EC 4.2.1.1, FLJ37995, MGC59868 |
Gene ID (Entrez) | 377677 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase XIII/CA13 (Accession#: NP_940986.1; Met 1-His 262) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:25000-1:50000, Immunohistochemistry 1:5000-1:25000, Immunoprecipitation 0.2-1 μL/mg of lysate, Immunohistochemistry-Paraffin |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase VIII/CA8 (Accession#: P28651; Met1-Gln291) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Gene Symbols | CA5B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human Carbonic Anhydrase VB/CA5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | Carbonic Anhydrase X/CA10 |
Gene Symbols | CA10 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P35219 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Gene Symbols | CA8 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Molecular Weight of Antigen | 32 kDa |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Immunogen | Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC. |
Classification | Polyclonal |
Primary or Secondary | Primary |