Primary Antibodies

Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

1
–
15
of
1,762
results
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VI |
Gene Symbols | CA6 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
Gene ID (Entrez) | 765 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase X/CA10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA |
Form | Purified |
Isotype | IgG |
Antigen | Carbonic Anhydrase X/CA10 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000 |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase X/CA10 (Accession#: P61215; Met1-Asn300) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | P35218 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VA/CA5A |
Gene Symbols | CA5A |
Regulatory Status | RUO |
Molecular Weight of Antigen | 34 kDa |
Gene Alias | CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1 |
Gene ID (Entrez) | 763 |
Immunogen | Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VIII/CA8 (Accession#: NP_004047.3; Met 1-Gln 290) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q86YU0 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Gene Symbols | CA7 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 23 kDa |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Immunogen | Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000 |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XII/CA12 |
Gene Symbols | CA12 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
Gene ID (Entrez) | 771 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VII/CA7 (Accession#: P43166; Met1-Ala264) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase XIII/CA13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIII/CA13 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 4-6 uL/mg of lysate |
Gene Alias | carbonic anhydrase 13, carbonic anhydrase XIIICarbonate dehydratase XIII, CAXIII, CA-XIII, EC 4.2.1.1, FLJ37995, MGC59868 |
Gene ID (Entrez) | 377677 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase XIII/CA13 (Accession#: NP_940986.1; Met 1-His 262) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase IX/CA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision |
Antigen | Carbonic Anhydrase IX/CA9 |
Gene Symbols | CA9 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Gene Alias | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
Gene ID (Entrez) | 768 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:25000-1:50000, Immunohistochemistry 1:5000-1:25000, Immunoprecipitation 0.2-1 ÎĽL/mg of lysate, Immunohistochemistry-Paraffin |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase VIII/CA8 (Accession#: P28651; Met1-Gln291) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIV/CA14 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:5000-1:10000 |
Gene Alias | Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1 |
Gene ID (Entrez) | 23632 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase XIV/CA14 (Accession#: NP_035927.1; Met 1-Met 290) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Gene Symbols | CA8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals Carbonic Anhydrase X/CA10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | Q9NS85 |
Antigen | Carbonic Anhydrase X/CA10 |
Gene Symbols | CA10 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |