Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

All Primary Antibodies (1,859)

Primary Antibody Matched Pairs (1)

1 – 15 of 1,762 results

Novus Biologicals Carbonic Anhydrase VI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VI
Gene Symbols	CA6
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase
Gene ID (Entrez)	765
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Novus Biologicals Carbonic Anhydrase X/CA10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA
Form	Purified
Isotype	IgG
Antigen	Carbonic Anhydrase X/CA10
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:2000, ELISA 1:5000-1:10000
Gene Alias	carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15
Gene ID (Entrez)	56934
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase X/CA10 (Accession#: P61215; Met1-Asn300)
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne Carbonic Anhydrase VA/CA5A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	P35218
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VA/CA5A
Gene Symbols	CA5A
Regulatory Status	RUO
Molecular Weight of Antigen	34 kDa
Gene Alias	CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1
Gene ID (Entrez)	763
Immunogen	Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS.
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunoprecipitation
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VIII/CA8
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate
Gene Alias	CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502
Gene ID (Entrez)	767
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VIII/CA8 (Accession#: NP_004047.3; Met 1-Gln 290)
Classification	Polyclonal
Primary or Secondary	Primary

Bio-Techne Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Gene Accession No.	Q86YU0
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VII/CA7
Gene Symbols	CA7
Regulatory Status	RUO
Molecular Weight of Antigen	23 kDa
Gene Alias	Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1
Gene ID (Entrez)	766
Immunogen	Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR.
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunofluorescence
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VB/CA5B
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	ELISA 1:5000-1:10000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000
Gene Alias	Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962
Gene ID (Entrez)	11238
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase VB/CA5B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunoprecipitation
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VB/CA5B
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate
Gene Alias	Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962
Gene ID (Entrez)	11238
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunofluorescence
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase XII/CA12
Gene Symbols	CA12
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3
Gene ID (Entrez)	771
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Novus Biologicals Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VII/CA7
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	ELISA 1:5000-1:10000
Gene Alias	Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1
Gene ID (Entrez)	766
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VII/CA7 (Accession#: P43166; Met1-Ala264)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase XIII/CA13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunoprecipitation
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase XIII/CA13
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 4-6 uL/mg of lysate
Gene Alias	carbonic anhydrase 13, carbonic anhydrase XIIICarbonate dehydratase XIII, CAXIII, CA-XIII, EC 4.2.1.1, FLJ37995, MGC59868
Gene ID (Entrez)	377677
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase XIII/CA13 (Accession#: NP_940986.1; Met 1-His 262)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase IX/CA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunocytochemistry,Immunofluorescence
Isotype	IgG
Research Discipline	Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision
Antigen	Carbonic Anhydrase IX/CA9
Gene Symbols	CA9
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250
Gene ID (Entrez)	768
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VIII/CA8
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:1000, ELISA 1:25000-1:50000, Immunohistochemistry 1:5000-1:25000, Immunoprecipitation 0.2-1 μL/mg of lysate, Immunohistochemistry-Paraffin
Gene Alias	CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502
Gene ID (Entrez)	767
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase VIII/CA8 (Accession#: P28651; Met1-Gln291)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase XIV/CA14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ELISA
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase XIV/CA14
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	Western Blot 1:500-1:1000, ELISA 1:5000-1:10000
Gene Alias	Carbonate dehydratase XIV, carbonic anhydrase XIVcarbonic anhydrase 14, carbonic dehydratase, CAXiV, CA-XIV, EC 4.2.1.1
Gene ID (Entrez)	23632
Formulation	0.2 um filtered solution in PBS
Immunogen	Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase XIV/CA14 (Accession#: NP_035927.1; Met 1-Met 290)
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	Carbonic Anhydrase VIII/CA8
Gene Symbols	CA8
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias	CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502
Gene ID (Entrez)	767
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Novus Biologicals Carbonic Anhydrase X/CA10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Gene Accession No.	Q9NS85
Antigen	Carbonic Anhydrase X/CA10
Gene Symbols	CA10
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15
Gene ID (Entrez)	56934
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Primary Antibodies

Primary Antibodies

Selected Filters

Narrow Results

Narrow Results

Filtered Search Results