All Primary Antibodies

All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (30)
- (1)
- (795)
- (8)
- (8)
- (8)
- (267)
- (21)
- (17)
- (16)
- (13)
- (108)
- (26)
- (191)
- (445)
- (21)
- (731)
- (123)
- (1)
- (1)
- (3)
- (3)
- (8)
- (2)
- (7)
- (1)
- (1)
- (5)
- (715)
- (40)
- (16)
- (654)
- (952)
- (6)
- (5)
- (3)
- (4)
- (1)
- (1)
- (1,316)
- (25)
- (1)
- (1)
- (2)
- (21)
- (146)
- (3)
- (16)
- (18)
- (9)
- (1)
- (1)
- (15)
- (34)
- (1)
- (8)
- (43)
- (1)
- (1)
- (1)
- (31)
- (3)
- (51)
- (51)
- (50)
- (50)
- (51)
- (49)
- (51)
- (51)
- (61)
- (50)
- (50)
- (50)
- (50)
- (50)
- (50)
- (50)
- (50)
- (50)
- (48)
- (1)
- (51)
- (14)
- (42)
- (14)
- (14)
- (42)
- (14)
- (34)
- (3)
- (3)
- (3)
- (32)
- (1)
- (322)
- (29)
- (27)
- (29)
- (1,276)
- (394)
- (1)

Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VI |
Gene Symbols | CA6 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
Gene ID (Entrez) | 765 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA |
Form | Purified |
Isotype | IgG |
Antigen | Carbonic Anhydrase X/CA10 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000 |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase X/CA10 (Accession#: P61215; Met1-Asn300) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | P35218 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VA/CA5A |
Gene Symbols | CA5A |
Regulatory Status | RUO |
Molecular Weight of Antigen | 34 kDa |
Gene Alias | CA5carbonic anhydrase 5A, mitochondrial, Carbonate dehydratase VA, carbonic anhydrase V, mitochondrial, Carbonic anhydrase VA, carbonic anhydrase VA, mitochondrial, carbonic dehydratase, CAV, CAVA, CA-VA, EC 4.2.1.1 |
Gene ID (Entrez) | 763 |
Immunogen | Synthetic peptides corresponding to CA5A (carbonic anhydrase VA, mitochondrial) The peptide sequence was selected from the C terminal of CA5A. Peptide sequence PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VIII/CA8 (Accession#: NP_004047.3; Met 1-Gln 290) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q86YU0 |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VII/CA7 |
Gene Symbols | CA7 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 23 kDa |
Gene Alias | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
Gene ID (Entrez) | 766 |
Immunogen | Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | Q9NS85 |
Antigen | Carbonic Anhydrase X/CA10 |
Gene Symbols | CA10 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Hypoxia, Lipid and Metabolism |
Antigen | Carbonic Anhydrase I/CA1 |
Gene Symbols | CA1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Gene Alias | CA-I, Car1, Carbonate dehydratase I, carbonic anhydrase 1, Carbonic anhydrase B, carbonic anhydrase ICAB, carbonic dehydratase, EC 4.2.1.1 |
Gene ID (Entrez) | 759 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Gene Symbols | CA8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000 |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase VB/CA5B (Uniprot#: Q9Y2D0; Cys34-Pro317) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunoprecipitation |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase XIII/CA13 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 4-6 uL/mg of lysate |
Gene Alias | carbonic anhydrase 13, carbonic anhydrase XIIICarbonate dehydratase XIII, CAXIII, CA-XIII, EC 4.2.1.1, FLJ37995, MGC59868 |
Gene ID (Entrez) | 377677 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Human Carbonic Anhydrase XIII/CA13 (Accession#: NP_940986.1; Met 1-His 262) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VIII/CA8 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:1000, ELISA 1:25000-1:50000, Immunohistochemistry 1:5000-1:25000, Immunoprecipitation 0.2-1 μL/mg of lysate, Immunohistochemistry-Paraffin |
Gene Alias | CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 |
Gene ID (Entrez) | 767 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse Carbonic Anhydrase VIII/CA8 (Accession#: P28651; Met1-Gln291) |
Classification | Polyclonal |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision |
Antigen | Carbonic Anhydrase IX/CA9 |
Gene Symbols | CA9 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Gene Alias | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
Gene ID (Entrez) | 768 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Carbonic Anhydrase VB/CA5B |
Gene Symbols | CA5B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 |
Gene Alias | Carbonate dehydratase VB, carbonic anhydrase 5B, mitochondrial, Carbonic anhydrase VB, carbonic anhydrase VB, mitochondrial, carbonic dehydratase, CA-VB, EC 4.2.1.1, MGC39962 |
Gene ID (Entrez) | 11238 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human Carbonic Anhydrase VB/CA5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | Carbonic Anhydrase X/CA10 |
Gene Symbols | CA10 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
Gene ID (Entrez) | 56934 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |