Recombinant Proteins

Recombinant Proteins
- (2)
- (11)
- (1,857)
- (101)
- (1)
- (1)
- (45)
- (8)
- (15)
- (1)
- (331)
- (1)
- (28,102)
- (1)
- (8)
- (3)
- (15)
- (1)
- (3)
- (6)
- (1)
- (7)
- (1)
- (3)
- (2)
- (3)
- (4)
- (3)
- (2)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (5,819)
- (197)
- (16)
- (15)
- (8)
- (4)
- (1)
- (3)
- (2)
- (6)
- (218)
- (4)
- (802)
- (1)
- (14)
- (53)
- (2)
- (2)
- (1)
- (42)
- (7)
- (44)
- (27)
- (2)
- (52)
- (128)
- (142)
- (13)
- (12)
- (2)
- (8)
- (2)
- (153)
- (4)
- (3)
- (3)
- (2)
- (2)
- (2)
- (14)
- (30,024)
- (4,493)
- (2)
- (4)
- (2,851)
- (1)
- (28,533)
- (65)
- (4,608)
- (24)
- (1)
- (8)
- (2)
- (8)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (248)
- (14)
- (1)
- (1)
- (28)
- (2)
- (48,670)
- (23)
- (2)
- (4)
- (32)
- (2)
- (685)
- (4)
- (3)
- (118)
- (47)
- (1,566)
- (3)
- (1)
- (7)
- (3)
- (19,642)
- (24)
- (31)
- (19)
- (1)
- (70)
- (16)
- (3)
- (77)
- (150)
- (98)
- (13)
- (4)
- (1)
- (132)
- (4)
- (1)
- (26)
- (11)
- (4)
- (1)
- (10)
- (10)
- (2)
- (4)
- (4,209)
- (4)
- (1)
- (1)
- (3)
- (47,860)
- (1)
- (1)
- (62)
- (4)
- (5)
- (3)
- (6)
- (1)
- (1)
- (8,202)
- (4)
- (4)
- (1)
- (2)
- (5)
- (2)
- (1)
- (1)
- (48,341)
- (14)
- (38,171)
- (18)
- (3)
- (1)
- (26,378)
- (1,141)
- (3,661)
- (144)
- (16)
- (3,400)
- (2)
- (54)
- (55)
- (4)
- (4)
- (1)
- (351)
- (1)
- (2)
- (2)
- (1)
- (1)
- (99)
- (2)
- (2)
- (2)
- (2)
- (1)
- (13)
- (666)
- (1)
- (48)
- (12,980)
- (2)
- (2)

R&D Systems™ Bovine Fibronectin Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
---|---|
Conjugate | Unconjugated |
Gene ID (Entrez) | 280794 |
Formulation | Supplied as a 0.2μm filtered solution in Tris-HCl, NaCl and Urea. |
Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after opening. Avoid vortexing and excessive agitation. |
Source | Bovine plasma-derived Fibronectin protein |
Name | Fibronectin |
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
---|---|
Gene Alias | Apo-F, apolipoprotein F, DKFZp781G18150, Lipid transfer inhibitor protein, LTIP, MGC22520 |
Molecular Weight (g/mol) | M.W. (Theoretical): 57.64 kDa |
Gene ID (Entrez) | 319 |
Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Symbol | APOF |
Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
For Use With (Application) | Western Blot,ELISA,Protein Array,Mass Spectrometry,Immunoaffinity Purification |
Protein | Apolipoprotein F |
Form | Solution |
---|---|
pH Range | 8 |
Common Name | DCP2 |
Molecular Weight (g/mol) | 68.09 |
Gene Symbol | DCP2 |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
For Use With (Application) | Antibody Production,Protein Array,ELISA,Western Blot |
Source | Wheat Germ (in vitro) |
Name | DCP2 (Human) Recombinant Protein (P01) |
Accession Number | AAH64593 |
Purification Method | Glutathione Sepharose 4 Fast Flow |
Preparation Method | In vitro wheat germ expression system |
Gene Alias | FLJ33245/NUDT20 |
Gene ID (Entrez) | 167227 |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Immunogen | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cross Reactivity | Human |
Protein Tag | GST |
Species | Wheat Germ (in vitro) |
Recombinant | Recombinant |
Abnova™ Human TLR2 Partial ORF (AAH33756.1, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re

Form | Liquid |
---|---|
Common Name | TLR2 |
Molecular Weight (g/mol) | 36.63kDa |
Gene Symbol | TLR2 |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Expression System | wheat germ expression system |
For Use With (Application) | Antibody Production,ELISA,Protein Array,Western Blot |
Name | TLR2 (Human) Recombinant Protein (Q01) |
Accession Number | AAH33756.1 |
Regulatory Status | RUO |
Gene Alias | CD282/TIL4 |
Gene ID (Entrez) | 7097 |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Immunogen | KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Protein Tag | GST |
Species | Wheat Germ (in vitro) |
Recombinant | Recombinant |
Corning™ Laminin, Mouse
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program

This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth
Thermo Scientific™ Pierce™ Bovine Serum Albumin, Biotinylated
Purified biotin and biotinylated BSA, HRP, AP or FITC for use as controls or to amplify signal in IHC via the avidin-biotin complex (ABC).
Corning™ Ultrapure Laminin, Mouse
SureTRACE
Supports traceability with guaranteed access to certificates and proactive change notifications.
Learn More
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program

Supports traceability with guaranteed access to certificates and proactive change notifications.
Learn More

This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth
Thermo Scientific™ VitroEase™ Apoferritin Standard
The Thermo Scientific™ VitroEase™ Apoferritin Standard is a highly validated pure protein for use as a quality control sample for cryo-electron microscopy single particle analysis.
R&D Systems™ Recombinant Human IFN-alpha I (alpha 17) Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Source | Human |
---|---|
Recombinant | Recombinant |
Name | rLaminin-521, Human |
Packaging | Amber Glass |
---|
Molecular Weight (g/mol) | 57 |
---|---|
Packaging | Poly Micro Tube |
Name | Vimentin |
Corning™ rLaminin-521, Human
Corning™ extracellular matrices (ECMs) enable researchers to mimic in vivo environments for 2D and 3D cell culture applications.
BD Recombinant Human Monocyte chemoattractant protein-1 (MCP-1)
Potent chemoattractant for monocytes and it also activates lymphocytes, basophils and NK cells