UserName
Rabbit Monoclonal Antibody
Provides single-step staining for the verification of human MSCs
Rabbit Monoclonal Antibody
Rabbit Monoclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Cancer |
Antigen | SPARC-like 1/SPARCL1 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | ELISA 1:5000-1:10000 |
Gene Alias | hevin, High endothelial venule protein, MAST 9, MAST9, PIG33, proliferation-inducing protein 33, SC1, SPARC-like 1 (hevin), SPARC-like 1 (mast9, hevin), SPARC-like protein 1 |
Gene ID (Entrez) | 8404 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Produced in rabbits immunized with purified, recombinant Mouse SPARC-like 1/SPARCL1 (Accession#: EDL20231.1; Met1-Phe650) |
Classification | Polyclonal |
Primary or Secondary | Primary |
pCLNDX expression vector is part of RetroMax system designed for maximal virus titer in 293 cells
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
---|---|
Gene Alias | DNA polymerase iota, EC 2.7.7.7, Eta2, polymerase (DNA directed) iota, RAD30 homolog B, RAD30Bpolymerase (DNA-directed), iota, RAD3OB |
Molecular Weight (g/mol) | MolecularWeight-theroretical: 106.7 kDa |
Gene ID (Entrez) | 11201 |
Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Symbol | POLI |
Research Category | DNA Polymerases, DNA Repair |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
Protein | DNA Polymerase iota |
Rabbit Monoclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Antigen | OCTN1/SLC22A4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:1000-1:2000 |
Gene Alias | Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H |
Gene ID (Entrez) | 6583 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
Classification | Polyclonal |
Primary or Secondary | Primary |