Primary Antibodies

Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

1
–
15
of
25
results
Abnova histidine ammonia-lyase, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a full-length human HAL protein.
Abnova glutamate-ammonia ligase (glutamine synthetase), Mouse, Clone: 3B6, Abnova™
Mouse monoclonal antibody raised against a partial recombinant GLUL.
Abnova histidine ammonia-lyase, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against a full-length human HAL protein.
Abnova glutamate-ammonia ligase (glutamine synthetase), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against a full-length human GLUL protein.
Novus Biologicals Actin Gamma 1 Antibody (NH3), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Rabbit |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen) |
Form | Purified |
Isotype | IgM |
Gene Accession No. | P63261 |
Concentration | 1.0 mg/mL |
Antigen | F-Actin |
Gene Symbols | ACTG1 |
Regulatory Status | RUO |
Purification Method | IgM purified |
Dilution | Western Blot 1:100-1:500, Flow Cytometry 1:10, ELISA 1:10, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500 |
Gene Alias | actin, cytoplasmic 2, DFNA26, ACT, ACTG, actin, gamma 1, BRWS2, DFNA20 |
Gene ID (Entrez) | 71 |
Immunogen | Human monocytes and U937 cell line |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Recognizes human Filamentous actin (F-actin). The binds to the N-terminal region of actin, but not to the extreme N-terminal 40 amino acids. In tissue sections the stains the cytoplasm of macrophages strongly, and gives granular, localized nuclear staining of all cell types. |
Clone | NH3 |
Content And Storage | Store undiluted at -20°C. |
---|---|
Description | Glutamate-Ammonia Ligase; GLUL; GLNS |
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG2a |
Research Discipline | Cell Biology |
Concentration | 250μg/mL |
Antigen | Glutamine Synthetase |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Formulation | Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide. |
Immunogen | Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 6 |
Content And Storage | -20°C |
---|---|
Target Species | Human,Rat,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P21213, P35492, P42357 |
Concentration | 0.17 mg/mL |
Antigen | HAL |
Gene Symbols | Hal |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | HAL, HIS, Histidase, histidine ammonia lyase, HSTD |
Gene | HAL |
Product Type | Antibody |
Gene ID (Entrez) | 15109, 29301, 3034 |
Formulation | PBS with 50% glycerol and 0.1% sodium azide; pH 7.3 |
Immunogen | HAL Fusion Protein Ag22985 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Proteintech CTP synthase Rabbit anti-Human, Mouse, Rat, Polyclonal, Proteintech
Rabbit Polyclonal Antibody
Content And Storage | -20°C |
---|---|
Target Species | Mouse,Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunoprecipitation,Immunofluorescence,Immunocytochemistry,Immunohistochemistry (Paraffin),Flow Cytometry |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P17812, P70698 |
Concentration | 0.16 mg/mL |
Antigen | CTP synthase |
Gene Symbols | Ctps, Ctps1 |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | CTP synthase, CTP synthase 1, CTP synthetase 1, CTPS, CTPS 1, CTPS1, UTP ammonia ligase 1 |
Gene | CTPS1 |
Product Type | Antibody |
Gene ID (Entrez) | 1503, 313560, 51797 |
Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.3 |
Immunogen | CTP synthase Fusion Protein Ag8707 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C |
---|---|
Target Species | Mouse,Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P70303, Q5U2N0, Q9NRF8 |
Concentration | 0.19 mg/mL |
Antigen | CTPS2 |
Gene Symbols | Ctps2 |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | CTP synthase 2, CTP synthase II, CTP synthetase 2, CTPS2, UTP ammonia ligase 2 |
Gene | CTPS2 |
Product Type | Antibody |
Gene ID (Entrez) | 55936, 56474, 619580 |
Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.3 |
Immunogen | CTPS2 Fusion Protein Ag3490 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Bio-Techne CPS1 Antibody (CPS1/1022) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Canine |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunofluorescence |
Form | Purified |
Isotype | IgG1 |
Concentration | 1.0 mg/mL |
Antigen | CPS1 |
Gene Symbols | CPS1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin : 0.25 - 0.5 ug/ml, Immunofluorescence : 0.5 - 1.0 ug/ml |
Gene Alias | carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16 |
Gene ID (Entrez) | 1373 |
Formulation | PBS with No Preservative |
Immunogen | Recombinant human CPS1 protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | This MAb recognizes a protein of 165kDa, identified as carbamoyl phosphate synthetase 1 (CPS1). This mitochondrial enzyme catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells.Deficiency of CPS1 is an autosomal recessive disorder that causes hyperammonemia. CPS1 is a hepatocyte specific protein that localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. CPS1 may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of CPS1 correlates with smaller tumor size and longer patient survival. Occasionally, CPS1 is also found in gastric carcinomas as well as in a few other non-hepatic tumors. |
Clone | CPS1/1022 |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P31327 |
Antigen | CPS1 |
Gene Symbols | CPS1 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Molecular Weight of Antigen | 165 kDa |
Gene Alias | carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16 |
Gene ID (Entrez) | 1373 |
Immunogen | Synthetic peptides corresponding to CPS1(carbamoyl-phosphate synthetase 1, mitochondrial) The peptide sequence was selected from the middle region of CPS1. Peptide sequence YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Proteintech Glutamine synthetase Rabbit anti-Human, Mouse, Rat, Polyclonal, Proteintech
Rabbit Polyclonal Antibody
Content And Storage | -20°C |
---|---|
Target Species | Mouse,Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunofluorescence,Western Blot,Immunocytochemistry,Flow Cytometry |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P09606, P15104, P15105 |
Concentration | 0.17 mg/mL |
Antigen | Glutamine synthetase |
Gene Symbols | GLUL |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | GLNS, GLUL, Glutamate ammonia ligase, Glutamate decarboxylase, Glutamine synthetase, GS, PIG43, PIG59 |
Gene | GLUL |
Product Type | Antibody |
Gene ID (Entrez) | 14645, 24957, 2752 |
Formulation | PBS with 50% glycerol and 0.1% sodium azide; pH 7.3 |
Immunogen | Glutamine synthetase Fusion Protein Ag1510 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Bio-Techne CPS1 Antibody (SPM615) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Canine |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunofluorescence |
Form | Purified |
Isotype | IgG1 |
Concentration | 1.0 mg/mL |
Antigen | CPS1 |
Gene Symbols | CPS1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin : 0.25 - 0.5 ug/ml, Immunofluorescence : 0.5 - 1.0 ug/ml |
Gene Alias | carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16 |
Gene ID (Entrez) | 1373 |
Formulation | PBS with No Preservative |
Immunogen | Recombinant human CPS1 protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | This MAb recognizes a protein of 165kDa, identified as carbamoyl phosphate synthetase 1 (CPS1). This mitochondrial enzyme catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells.Deficiency of CPS1 is an autosomal recessive disorder that causes hyperammonemia. CPS1 is a hepatocyte specific protein that localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. CPS1 may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of CPS1 correlates with smaller tumor size and longer patient survival. Occasionally, CPS1 is also found in gastric carcinomas as well as in a few other non-hepatic tumors. |
Clone | SPM615 |